HPA021555

JAG1 antibody from Sigma-Aldrich
AGS, AHD, AWS, CD339, HJ1, JAGL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021555
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021555, RRID:AB_1851969
Product name
Anti-JAG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021555
Antibody type
Polyclonal
Antigen
Protein jagged-1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIE
KHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMD
KHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWT
NKQDNRDLESAQSLNRMEYI
Storage
-20C
Provider Type Product Number
- No reagents -