HPA037676

TANK antibody from Atlas Antibodies
I-TRAF, TRAF2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA037676
Provider
Atlas Antibodies
Product name
Anti-TANK
Provider product page
Atlas Antibodies - HPA037676
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRI
REQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCV
PLLEDSETRKNNLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -