HPA037676

TANK antibody from Atlas Antibodies
I-TRAF, TRAF2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA037676
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037676, RRID:AB_2675601
Product name
Anti-TANK
Provider product page
Atlas Antibodies - HPA037676
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRI
REQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCV
PLLEDSETRKNNLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -