H00010010-A01

TANK antibody from Abnova Corporation
I-TRAF, TRAF2
No application information provided.

Antibody data

Product number
H00010010-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010010-A01, RRID:AB_461854
Product name
TANK polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00010010-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant TANK.
Antigen sequence
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTE
NYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQD
NNYGCVPLLEDSETRKNNLTLDQPQDKVISGIARE
KLPKVDIASAESSI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -