Antibody data

Product number
ABIN971845
Provider
antibodies-online
Product name
anti-TRAF Family Member-Associated NFKB Activator (TANK) (N-Term) antibody
Provider product page
antibodies-online - ABIN971845
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human, Rat
Host
Rabbit
Antigen sequence
MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQT
ENYEQ RIREQQEQLS
Vial size
50ug
Provider Type Product Number
- No reagents -