H00010818-M02

FRS2 antibody from Abnova Corporation
FRS2A, FRS2alpha, SNT-1, SNT1

Antibody data

Product number
H00010818-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010818-M02, RRID:AB_1204372
Product name
FRS2 monoclonal antibody (M02), clone 1F7-1D6
Provider product page
Abnova Corporation - H00010818-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial length recombinant FRS2.
Antigen sequence
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGS
GIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSN
LFSFESGRRCQTGQGIFAFKCARAEELFNMSQEIM
QNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPG
FAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARL
PSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRT
SVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLE
PEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSG
ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIP
SASGVRRGRLTSTSTSDTQNINNSAQ
Isotype
IgG
Antibody clone number
1F7-1D6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -