HPA006007

JADE3 antibody from Atlas Antibodies
JADE-3, KIAA0215, PHF16
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006007
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006007, RRID:AB_1079605
Product name
Anti-JADE3
Provider product page
Atlas Antibodies - HPA006007
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLESK
NNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSL
GKPLVLQAALHGQSSIGNGKSQPNSKFAKSNGLEG
SWSGNVTQKDSSSEMFCDQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -