HPA006007

JADE3 antibody from Sigma-Aldrich
JADE-3, KIAA0215, PHF16
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006007
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006007, RRID:AB_1079605
Product name
Anti-PHF16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006007
Antibody type
Polyclonal
Antigen
Protein Jade-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLESK
NNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSL
GKPLVLQAALHGQSSIGNGKSQPNSKFAKSNGLEG
SWSGNVTQKDSSSEMFCDQ
Storage
-20C
Provider Type Product Number
- No reagents -