HPA039310
antibody from Atlas Antibodies
Targeting: RAD51
BRCC5, FANCR, HsRad51, HsT16930, RAD51A, RECA
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039310 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039310, RRID:AB_2676434
- Product name
- Anti-RAD51
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINA
NDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK
A- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Radiation-induced synthetic lethality: combination of poly(ADP-ribose) polymerase and RAD51 inhibitors to sensitize cells to proton irradiation
Downregulation of DNA repair proteins and increased DNA damage in hypoxic colon cancer cells is a therapeutically exploitable vulnerability
Wéra A, Lobbens A, Stoyanov M, Lucas S, Michiels C
Cell Cycle 2019;18(15):1770-1783
Cell Cycle 2019;18(15):1770-1783
Downregulation of DNA repair proteins and increased DNA damage in hypoxic colon cancer cells is a therapeutically exploitable vulnerability
Jongen J, van der Waals L, Trumpi K, Laoukili J, Peters N, Schenning-van Schelven S, Govaert K, Borel Rinkes I, Kranenburg O
Oncotarget 2017;8(49):86296-86311
Oncotarget 2017;8(49):86296-86311
No comments: Submit comment
No validations: Submit validation data