Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001131-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001131-A01, RRID:AB_462505
- Product name
- CHRM3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CHRM3.
- Antigen sequence
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVT
HFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Airway hyperresponsiveness induced by repeated esophageal infusion of HCl in guinea pigs.
Cheng YM, Cao AL, Zheng JP, Wang HW, Sun YS, Liu CF, Zhang BB, Wang Y, Zhu SL, Wu DZ
American journal of respiratory cell and molecular biology 2014 Nov;51(5):701-8
American journal of respiratory cell and molecular biology 2014 Nov;51(5):701-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CHRM3 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of CHRM3 expression in PC-12 ( Cat # L012V1 ).