HPA000258

DACH2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000258
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000258, RRID:AB_1078618
Product name
Anti-DACH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000258
Antibody type
Polyclonal
Antigen
Dachshund homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESE
PDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAH
AALAGQPGIGGAPTLNPLQQNHLLTNRLDLPFMMM
PHPLLPVSLPPASV
Storage
-20C
Provider Type Product Number
- No reagents -