Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310208 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 2 (SLC2A2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC2A2 antibody: synthetic peptide directed towards the N terminal of human SLC2A2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVP
LDDRK AINNYVINST- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Polymorphisms in the SLC2A2 (GLUT2) gene are associated with the conversion from impaired glucose tolerance to type 2 diabetes: the Finnish Diabetes Prevention Study.
Laukkanen O, Lindström J, Eriksson J, Valle TT, Hämäläinen H, Ilanne-Parikka P, Keinänen-Kiukaanniemi S, Tuomilehto J, Uusitupa M, Laakso M, Finnish Diabetes Prevention Study
Diabetes 2005 Jul;54(7):2256-60
Diabetes 2005 Jul;54(7):2256-60
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: SLC2A2 Sample Tissue: Fetal LungLane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 μg/mL Peptide Concentration: 5 μg/mL Lysate Quantity: 41 μg/laneGel Concentration:.12 %