Antibody data

Product number
H00004793-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004793-M06, RRID:AB_1237797
Product name
NFKBIB monoclonal antibody (M06), clone 1G6
Provider product page
Abnova Corporation - H00004793-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NFKBIB.
Antigen sequence
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPG
LGAELGPGLSWAPLVFGYVTEDGDTALHLAVIHQH
EPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILG
ETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAH
ACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHT
PVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTP
LHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPL
HLAVEAQAADVLELLLRAGANPAARMYGGRTPLGS
AMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSS
DSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLP
DDPRPV
Isotype
IgG
Antibody clone number
1G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -