Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA066567 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA066567, RRID:AB_2685692
- Product name
- Anti-SKI
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAA
VSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAA
PEEDKDSEAEVEVESRE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Suppression of intrahepatic cholangiocarcinoma cell growth by SKI via upregulation of the CDK inhibitor p21.
Kawamura E, Matsubara T, Daikoku A, Deguchi S, Kinoshita M, Yuasa H, Urushima H, Odagiri N, Motoyama H, Kotani K, Kozuka R, Hagihara A, Fujii H, Uchida-Kobayashi S, Tanaka S, Takemura S, Iwaisako K, Enomoto M, Taguchi YH, Tamori A, Kubo S, Ikeda K, Kawada N
FEBS open bio 2022 Dec;12(12):2122-2135
FEBS open bio 2022 Dec;12(12):2122-2135
No comments: Submit comment
No validations: Submit validation data