H00002042-B01

EPHA3 antibody from Abnova Corporation
ETK, ETK1, HEK, HEK4, TYRO4

Antibody data

Product number
H00002042-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002042-B01, RRID:AB_1018123
Product name
EPHA3 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00002042-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EPHA3 protein.
Antigen sequence
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDS
KTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQV
CNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRD
CNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQF
TKIDTIAADESFTQMDLGDRILKLNTEIREVGPVN
KKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLA
MFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCS
TEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKA
LDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADK
DPPSMACTRPPSSPRNVISNINETSVILDWSWPLD
TGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPR
QFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISL
SWQEPEHPNGIILDYEVKYYEKQEQETSYTILRAR
GTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFE
FETSPDSFSISGESSQVVMIAISAAVAIILLTVVI
YVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRT
YVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAG
EFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRR
DFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTE
YMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMK
YLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRV
LEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSAS
DVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIV
SILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDI
TTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAK
ISTDDMKKVGVTVVGPQKKIISSIKALETQSKNGP
VPV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -