HPA025061

CDK11A antibody from Atlas Antibodies
CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, p58GTA, PITSLRE
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025061
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025061, RRID:AB_1846407
Product name
Anti-CDK11A
Provider product page
Atlas Antibodies - HPA025061
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YRREDSMEDRGEEDDSLAIKPPQQMSWKEKVHHRK
DEKRKEKCRHHSHSAEGGKHARVKEREHERRKRHR
EEQDKARREWERQKRREMAREHSRRERDRLE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -