HPA025061

CDK11A antibody from Sigma-Aldrich
CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, p58GTA, PITSLRE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025061
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025061, RRID:AB_1846407
Product name
Anti-CDC2L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025061
Antibody type
Polyclonal
Antigen
PITSLRE serine/threonine-protein kinase CDC2L2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YRREDSMEDRGEEDDSLAIKPPQQMSWKEKVHHRK
DEKRKEKCRHHSHSAEGGKHARVKEREHERRKRHR
EEQDKARREWERQKRREMAREHSRRERDRLE
Storage
-20C
Provider Type Product Number
- No reagents -