Antibody data

Product number
PAB22974
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22974, RRID:AB_11123023
Product name
ANO2 polyclonal antibody
Provider product page
Abnova Corporation - PAB22974
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human ANO2.
Reactivity
Human
Host
Rabbit
Antigen sequence
PTDISDQIKKEKSLLVDFFLKEEHEKLKLMDEPAL
RSPGGGDRSRSRAASSAPSGQSQLGSMMSSGSQHT
NV
Isotype
IgG
Vial size (┬Ál)
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -