H00001944-M10

EFNA3 antibody from Abnova Corporation
Ehk1-L, EPLG3, LERK3

Antibody data

Product number
H00001944-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001944-M10, RRID:AB_1574555
Product name
EFNA3 monoclonal antibody (M10), clone 2H3
Provider product page
Abnova Corporation - H00001944-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EFNA3.
Antigen sequence
RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGP
GGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPH
APHSPIKFSEKFQRYSAFSLGYEFHAGHEYY
Isotype
IgG
Antibody clone number
2H3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -