Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182452 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Forkhead Box A3 (FOXA3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FOXA3 antibody: synthetic peptide directed towards the middle region of human FOXA3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTG
SAAST TTPAATVTSP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier.
The hepatocyte nuclear factor 3 (HNF3 or FOXA) family in metabolism.
Menga A, Infantino V, Iacobazzi F, Convertini P, Palmieri F, Iacobazzi V
European neuropsychopharmacology : the journal of the European College of Neuropsychopharmacology 2013 Aug;23(8):978-87
European neuropsychopharmacology : the journal of the European College of Neuropsychopharmacology 2013 Aug;23(8):978-87
The hepatocyte nuclear factor 3 (HNF3 or FOXA) family in metabolism.
Kaestner KH
Trends in endocrinology and metabolism: TEM 2000 Sep;11(7):281-5
Trends in endocrinology and metabolism: TEM 2000 Sep;11(7):281-5
No comments: Submit comment
No validations: Submit validation data