Antibody data

Product number
H00009500-M14
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009500-M14, RRID:AB_1575681
Product name
MAGED1 monoclonal antibody (M14), clone 1G11
Provider product page
Abnova Corporation - H00009500-M14
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MAGED1.
Antigen sequence
MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQ
ISEAPPTNQATAAASPQSSQPPTANEMADIQVSAA
AARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPN
TQPKAAFKSQNATPKGPNAAYDFSQAATTGELAAN
KSEMAFKAQNATTKVGPNATYNFSQSLNANDLANS
RPKTPFKAWNDTTKAPTADTQTQNVNQAKMATSQA
DIETDPGISEPDGATAQTSADGSQAQNLESRTIIR
GKRTRKINNLNVEENSSGDQRRAPLAAGTWRSAPV
PVTTQNPPGAPPNVLWQTPLAWQNPSGWQNQTARQ
TPPARQSPPARQTPPAWQNPVAWQNPVIWPNPVIW
QNPVIWPNPIVWPGPVVWPNPLAWQNPPGWQTPPG
WQTPPGWQGPPDWQGPPDWPLPPDWPLPPDWPLPT
DWPLPPDWIPADWPIPPDWQNLRPSPNLRPSPNSR
ASQNPGAAQPRDVALLQERANKLVKYLMLKDYTKV
PIKRSEMLRDIIREYTDVYPEIIERACFVLEKKFG
IQLKEIDKEEHLYILISTPESLAGILGTTKDTPKL
GLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGV
RHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEY
EFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQ
FMEAADEALDALDAAAAEAEARAEARTRMGIGDEA
VSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFW
ARYHQNARSRFPQTFAGPIIGPGGTASANFAANFG
AIGFFWVE
Isotype
IgG
Antibody clone number
1G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -