H00010036-M02
antibody from Abnova Corporation
Targeting: CHAF1A
CAF-1, CAF1, CAF1B, CAF1P150, MGC71229, P150
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010036-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010036-M02, RRID:AB_534814
- Product name
- CHAF1A monoclonal antibody (M02), clone 1C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHAF1A.
- Antigen sequence
CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSD
DQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPK
LVNGKGPLDNFLRNRIETSIGQSTVIIDLT- Isotype
- IgG
- Antibody clone number
- 1C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Antibody against chromatin assembly factor-1 is a novel autoantibody specifically recognized in systemic lupus erythematosus.
Doe K, Nozawa K, Hiruma K, Yamada Y, Matsuki Y, Nakano S, Ogasawara M, Nakano H, Ikeda T, Ikegami T, Fujishiro M, Kawasaki M, Ikeda K, Amano H, Morimoto S, Ogawa H, Takamori K, Sekigawa I, Takasaki Y
Lupus 2014 Sep;23(10):1031-41
Lupus 2014 Sep;23(10):1031-41
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CHAF1A monoclonal antibody (M02), clone 1C2 Western Blot analysis of CHAF1A expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CHAF1A is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol