H00007139-M02

TNNT2 antibody from Abnova Corporation
CMD1D, CMH2, CMPD2

Antibody data

Product number
H00007139-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007139-M02, RRID:AB_1582173
Product name
TNNT2 monoclonal antibody (M02), clone 3H4-F7
Provider product page
Abnova Corporation - H00007139-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TNNT2.
Antigen sequence
MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAE
AETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSF
MPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQAL
IEAHFENRKKEEEELVSLKDRIERRRAERAEQQRI
RNEREKERQNRLAEERARREEEENRRKAEDEARKK
KALSNMMHFGGYIQKTERKSGKRQTEREKKKKILA
ERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKF
DLQEKFKQQKYEINVLRNRINDN
Isotype
IgG
Antibody clone number
3H4-F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -