Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [5]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90961 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90961, RRID:AB_2665734
- Product name
- Anti-MKI67IP
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKK
KVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVA
ELNDDDKDDEI- Epitope
- Binds to an epitope located within the peptide sequence KVSGTLDTPE as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL2240
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in HeLa cell line with Anti-MKI67IP monoclonal antibody, showing specific staining of nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in A431 cell line with Anti-MKI67IP monoclonal antibody, showing specific staining of nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in MCF7 cell line with Anti-MKI67IP monoclonal antibody, showing specific staining of nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in U2OS cell line with Anti-MKI67IP monoclonal antibody, showing specific staining of nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in U251 cell line with Anti-MKI67IP monoclonal antibody, showing specific staining of nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong nucleolar immunoreactivity in glandular and connective tissue cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix shows strong nucleolar positivity in the epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows nucleolar immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong nucleolar positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows nucleolar immunoreactivity in glandular and lamina propria cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong nucleolar positivity in renal tubules.