Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501865 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Cyclin B3 (CCNB3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVF
FEVAK IPALDMLKLE- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
Cheng J, Kapranov P, Drenkow J, Dike S, Brubaker S, Patel S, Long J, Stern D, Tammana H, Helt G, Sementchenko V, Piccolboni A, Bekiranov S, Bailey DK, Ganesh M, Ghosh S, Bell I, Gerhard DS, Gingeras TR
Science (New York, N.Y.) 2005 May 20;308(5725):1149-54
Science (New York, N.Y.) 2005 May 20;308(5725):1149-54
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting