Antibody data

Product number
ABIN501865
Provider
antibodies-online
Product name
anti-Cyclin B3 (CCNB3) (C-Term) antibody
Provider product page
antibodies-online - ABIN501865
Antibody type
Polyclonal
Antigen
The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVF
FEVAK IPALDMLKLE
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.