Explore
Validate
Learn
Immunocytochemistry
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000496 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000496, RRID:AB_1078605
- Product name
- Anti-CCNB3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KMCASQRKQSCQEESLAVQDVNMEEDSFFMESMSF
KKKPKTEESIPTHKLSSLKKKCTIYGKICHFRKPP
VLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHT
TEHEMS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references BCOR-CCNB3 fusions are frequent in undifferentiated sarcomas of male children.
A new subtype of bone sarcoma defined by BCOR-CCNB3 gene fusion.
Peters TL, Kumar V, Polikepahad S, Lin FY, Sarabia SF, Liang Y, Wang WL, Lazar AJ, Doddapaneni H, Chao H, Muzny DM, Wheeler DA, Okcu MF, Plon SE, Hicks MJ, López-Terrada D, Parsons DW, Roy A
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2015 Apr;28(4):575-86
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2015 Apr;28(4):575-86
A new subtype of bone sarcoma defined by BCOR-CCNB3 gene fusion.
Pierron G, Tirode F, Lucchesi C, Reynaud S, Ballet S, Cohen-Gogo S, Perrin V, Coindre JM, Delattre O
Nature genetics 2012 Mar 4;44(4):461-6
Nature genetics 2012 Mar 4;44(4):461-6
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and liver tissues using HPA000496 antibody. Corresponding CCNB3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
