HPA000496

CCNB3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000496
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000496, RRID:AB_1078605
Product name
Anti-CCNB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000496
Antibody type
Polyclonal
Antigen
G2/mitotic-specific cyclin-B3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KMCASQRKQSCQEESLAVQDVNMEEDSFFMESMSF
KKKPKTEESIPTHKLSSLKKKCTIYGKICHFRKPP
VLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHT
TEHEMS
Storage
-20C
Provider Type Product Number
- No reagents -