HPA021178

GOLGA2 antibody from Atlas Antibodies
GM130, golgin-95
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA021178
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021178, RRID:AB_1849837
Product name
Anti-GOLGA2
Provider product page
Atlas Antibodies - HPA021178
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKE
RVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKE
RHREKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -