HPA021178

GOLGA2 antibody from Atlas Antibodies
GM130, golgin-95
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA021178
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021178, RRID:AB_1849837
Product name
Anti-GOLGA2
Provider product page
Atlas Antibodies - HPA021178
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKE
RVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKE
RHREKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -