HPA021178

GOLGA2 antibody from Sigma-Aldrich
GM130, golgin-95
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021178
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021178, RRID:AB_1849837
Product name
Anti-GOLGA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021178
Antibody type
Polyclonal
Antigen
Golgin subfamily A member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKE
RVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKE
RHREKE
Storage
-20C
Provider Type Product Number
- No reagents -