HPA021799

GOLGA2 antibody from Sigma-Aldrich
GM130, golgin-95
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021799
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021799, RRID:AB_1849841
Product name
Anti-GOLGA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021799
Antibody type
Polyclonal
Antigen
Golgin subfamily A member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAAS
QNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLV
CESATCVNGEGPASSANLK
Storage
-20C
Provider Type Product Number
- No reagents -