HPA001510

RAB41 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001510
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001510, RRID:AB_1079733
Product name
Anti-RAB41 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001510
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-41 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKTSIISRFMYNSFGCACQATVGIDFLSKTMYLED
QIVQLQLWDTAGQERFHSLIPSYIRDSTIAVVVYD
ITNINSFKETDKWVEHVRAERGDDVVIMLLGNKID
LDNKRQVTAEQGEEKSRNLNVMFIETSAKTGYNVK
KVI
Storage
-20C
Provider Type Product Number
- No reagents -