SAB1401102

CYP1A2 antibody from Sigma-Aldrich
CP12, P3-450
No application information provided.

Antibody data

Product number
SAB1401102
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401102, RRID:AB_10609176
Product name
Anti-CYP1A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1401102
Antibody type
Polyclonal
Antigen
CYP1A2 (AAH67427.1, 1 a.a. ~ 516 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRV
PKGLKSPPEPWGWPLLGHVLTLGKNPHLALSRMSQ
RYGDVLQIRIDSTPVLVLSRLDTIRQALVRQGDDF
KGRPDLYTSTLITDGQSLTFSTDSGPVWAARRRLA
QNALNTFSIASDPASSSSCYLEEHVSKEAKALISR
LQELMAGPGHFDPYNQVVVSVANVIGAMCFGQHFP
ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYL
PNPALQRFKA
Storage
-20C
Provider Type Product Number
- No reagents -