Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030096 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030096, RRID:AB_10600997
- Product name
- Anti-CUL7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQE
SAGEVGALDKSVLEEMETDVKSLIQRALRQLEECV
GTIPPAPLLHTVH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?
Fahlbusch F, Dawood Y, Hartner A, Menendez-Castro C, Nögel S, Tzschoppe A, Schneider H, Strissel P, Beckmann M, Schleussner E, Ruebner M, Dörr H, Schild R, Rascher W, Dötsch J
The Journal of Maternal-Fetal & Neonatal Medicine 2012 July;25(11):2209-2215
The Journal of Maternal-Fetal & Neonatal Medicine 2012 July;25(11):2209-2215
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
- Sample type
- HUMAN