HPA004842

ANK1 antibody from Sigma-Aldrich
ANK, SPH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004842
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004842, RRID:AB_1844827
Product name
Anti-ANK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004842
Antibody type
Polyclonal
Antigen
Ankyrin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QNVMHIVRGSLCFVLKHIHQELDKELGESEGLSDD
EETISTRVVRRRVFLKGNEFQNIPGEQVTEEQFTD
EQGNIVTKKIIRKVVRQIDLSSADAAQEHEEVELR
GSGLQPDLIEGRKGAQIVKRASLK
Storage
-20C
Provider Type Product Number
- No reagents -