Antibody data

Product number
ABIN406785
Provider
antibodies-online
Product name
anti-HSF2 antibody
Provider product page
antibodies-online - ABIN406785
Antibody type
Polyclonal
Antigen
The immunogen for anti-HSF2 antibody: synthetic peptide directed towards the middle region of human HSF2
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
SSVQMNPTDYINNTKSENKGLETTKNNVVQPVSEE
GRKSK SKPDKQLIQY
Vial size
50 µg
Provider Type Product Number
- No reagents -