ABIN636056

antibody from antibodies-online

Targeting: APOB

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN636056 - Provider product page
Provider: antibodies-online
Product name: anti-Apolipoprotein B (APOB) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

APOB protein structure - ABIN636056 shown in red.