Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29501 - Provider product page

- Provider
- Abnova Corporation
- Product name
- APOB polyclonal antibody
- Antibody type
- Polyclonal
- Description
- APOB polyclonal antibody raised against recombinant human APOB.
- Antigen sequence
NFVASHIANILNSEELDIQDLKKLVKEALKESQLP
TVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLI
FDPNNYLPKESMLKTTLTAFGFASADLIE- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG, Lane 3: Human plasma, Lane 4: Human Liver tissue, Lane 5: Human Tonsil tissue with APOB polyclonal antibody (Cat# PAB29501) at 1:250 - 1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of Hep G2 cells with APOB polyclonal antibody (Cat# PAB29501) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with APOB polyclonal antibody (Cat# PAB29501) shows distinct positivity in plasma at 1:500 - 1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)