Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406376 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Coiled-Coil Domain Containing 70 (CCDC70) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CCDC70 antibody: synthetic peptide directed towards the middle region of human CCDC70
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEK
SFWEM EKSFREEEKT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
Alcohol dehydrogenase 2 variant is associated with cerebral infarction and lacunae.
Suzuki Y, Yamashita R, Shirota M, Sakakibara Y, Chiba J, Mizushima-Sugano J, Nakai K, Sugano S
Genome research 2004 Sep;14(9):1711-8
Genome research 2004 Sep;14(9):1711-8
Alcohol dehydrogenase 2 variant is associated with cerebral infarction and lacunae.
Suzuki Y, Fujisawa M, Ando F, Niino N, Ohsawa I, Shimokata H, Ohta S
Neurology 2004 Nov 9;63(9):1711-3
Neurology 2004 Nov 9;63(9):1711-3
No comments: Submit comment
No validations: Submit validation data