Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- MAB2374 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#MAB2374, RRID:AB_11188259
- Product name
- ABCC1 monoclonal antibody, clone IU5C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against synthetic peptide of ABCC1.
- Antigen sequence
SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF
- Isotype
- IgG
- Antibody clone number
- IU5C1
- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references The amino terminus of the human multidrug resistance transporter ABCC1 has a U-shaped folding with a gating function.
Chen Q, Yang Y, Li L, Zhang JT
The Journal of biological chemistry 2006 Oct 13;281(41):31152-63
The Journal of biological chemistry 2006 Oct 13;281(41):31152-63
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of ABCC1 in 10 ug of 293 transfected lysate using ABCC1 monoclonal antibody, clone IU5C1 (Cat # MAB2374). Lane 1 : empty vector. Lane 2 : ABCC1 transfected 293 lysate.