HPA002380

ABCC1 antibody from Sigma-Aldrich
GS-X, MRP, MRP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002380
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002380, RRID:AB_1844432
Product name
Anti-ABCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002380
Antibody type
Polyclonal
Antigen
Multidrug resistance-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLAR
DGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEA
KQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHH
NSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVY
WD
Storage
-20C
Provider Type Product Number
- No reagents -