HPA060363

MCRIP2 antibody from Atlas Antibodies
C16orf14, FAM195A, MGC15416
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA060363
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060363, RRID:AB_2684263
Product name
Anti-MCRIP2
Provider product page
Atlas Antibodies - HPA060363
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EESVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVE
RTPNPRLQNFVPIDLDEWWAQQFLARITSC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -