HPA024344

HNRNPM antibody from Atlas Antibodies
CEAR, HNRNPM4, HNRPM, HNRPM4, HTGR1, NAGR1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA024344
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024344, RRID:AB_1850879
Product name
Anti-HNRNPM
Provider product page
Atlas Antibodies - HPA024344
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NKMGGMEGPFGGGMENMGRFGSGMNMGRINEILSN
ALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGG
AGMERMGAGLGHGMDRVGSEIERMGLVMDRMGSVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -