HPA024344

HNRNPM antibody from Sigma-Aldrich
CEAR, HNRNPM4, HNRPM, HNRPM4, HTGR1, NAGR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024344
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024344, RRID:AB_1850879
Product name
Anti-HNRNPM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024344
Antibody type
Polyclonal
Antigen
Heterogeneous nuclear ribonucleoprotein M recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKMGGMEGPFGGGMENMGRFGSGMNMGRINEILSN
ALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGG
AGMERMGAGLGHGMDRVGSEIERMGLVMDRMGSVE
Storage
-20C
Provider Type Product Number
- No reagents -