H00002719-M01A

GPC3 antibody from Abnova Corporation
DGSX, OCI-5, SDYS, SGB, SGBS, SGBS1
No application information provided.

Antibody data

Product number
H00002719-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002719-M01A, RRID:AB_1204420
Product name
GPC3 monoclonal antibody (M01A), clone 2C12
Provider product page
Abnova Corporation - H00002719-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GPC3.
Antigen sequence
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLY
ILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDS
ALDINECLRGARRDLKVFGNFPKLIMTQVS
Isotype
IgM
Antibody clone number
2C12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -