HPA006316

GPC3 antibody from Sigma-Aldrich
DGSX, OCI-5, SDYS, SGB, SGBS, SGBS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006316
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006316, RRID:AB_1078994
Product name
Anti-GPC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006316
Antibody type
Polyclonal
Antigen
Glypican-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDC
GDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVD
DAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSM
A
Storage
-20C
Provider Type Product Number
- No reagents -