Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405649 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ATP2B4 antibody: synthetic peptide directed towards the middle region of human ATP2B4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLM
QLFNE INSRKIHGEK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Increased expression of plasma membrane Ca(2+)ATPase 4b in platelets from hypertensives: a new sign of abnormal thrombopoiesis?
Dally S, Chaabane C, Corvazier E, Bredoux R, Bobe R, Ftouhi B, Slimane H, Raies A, Enouf J
Platelets 2007 Nov;18(7):543-9
Platelets 2007 Nov;18(7):543-9
No comments: Submit comment
No validations: Submit validation data