H00005413-B02P

SEPTIN5 antibody from Abnova Corporation
H5, HCDCREL-1, PNUTL1, SEPT5

Antibody data

Product number
H00005413-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005413-B02P, RRID:AB_1580476
Product name
SEPT5 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00005413-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SEPT5 protein.
Antigen sequence
MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVH
RKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLY
KDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLT
IVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDE
SGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFM
KALHEKVNIVPLIAKADCLVPSEIRKLKERIREEI
DKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFA
VIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDF
VKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQM
TSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDE
ELRRMQEMLQRMKQQMQDQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -