HPA026846

NECTIN1 antibody from Atlas Antibodies
CD111, CLPED1, ED4, HIgR, HVEC, OFC7, PRR, PRR1, PVRL1, PVRR1, SK-12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026846
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026846, RRID:AB_1846226
Product name
Anti-NECTIN1
Provider product page
Atlas Antibodies - HPA026846
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKST
NGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTD
GTIRLSRLELEDEGVYICEFATFPTGNRESQLNLT
VMAKPTNWIEGTQAVLRAKKGQDD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -