H00003621-M05A

ING1 antibody from Abnova Corporation
p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a

Antibody data

Product number
H00003621-M05A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003621-M05A, RRID:AB_1237750
Product name
ING1 monoclonal antibody (M05A), clone 2F9
Provider product page
Abnova Corporation - H00003621-M05A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ING1.
Antigen sequence
DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQ
RALIRSQELGDEKIQIVSQMVELVENRTRQVDSHV
ELFEAQQELGDTAGNSGKAGADRPKGEAAA
Isotype
IgM
Antibody clone number
2F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -