HPA000266

FAM122B antibody from Atlas Antibodies
DKFZp686L20116, RP11-308B5.5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000266
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000266, RRID:AB_611975
Product name
Anti-FAM122B
Provider product page
Atlas Antibodies - HPA000266
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLR
TRRNSTTIMSRHSLEEGLDMVNRETAHEREMQTAM
QISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVS
PAPSPTRGFGKMFVSSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -