HPA000266

FAM122B antibody from Atlas Antibodies
DKFZp686L20116, RP11-308B5.5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000266
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000266, RRID:AB_1078801
Product name
Anti-FAM122B
Provider product page
Atlas Antibodies - HPA000266
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLR
TRRNSTTIMSRHSLEEGLDMVNRETAHEREMQTAM
QISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVS
PAPSPTRGFGKMFVSSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -