HPA019000

PHLDA1 antibody from Sigma-Aldrich
DT1P1B11, PHRIP, TDAG51
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019000
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019000, RRID:AB_1855309
Product name
Anti-PHLDA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019000
Antibody type
Polyclonal
Antigen
Pleckstrin homology-like domain family A member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILT
EEGLLLIPPKQLQHQQQQQQQQQQQQQQPGQGPAE
PSQPSGPAVASLEPPVKLKELHFSNMKTVDCVE
Storage
-20C
Provider Type Product Number
- No reagents -